General Education (150 Questions)


1.       The statement “He is the black sheep of the family.” is an example of which figure of speech?
a.       Metaphor                                                                   c. Personification
b.      Simile                                                                            d. Hyperbole
2.       In the courtroom, the judge said that the findings have no bearing because they are______________.
a.       Inaccurate                                                                   c. Confusing
b.      Inaudible                                                                     d. Inedible
3.       The newly elected president demonstrated APLOMB in dealing with the reporters. The capitalize word means:
a.       Nervousness                                                             c. Compusure
b.      Hesitation                                                                   d. Anger
4.       The victim request to reopen the case _____________ is very reasonable.
a.       Were                                                                             c. Is
b.      Are                                                                                 d. was
5.       Nostradamus’ APOCALYPTIC view of the future is one of the most alarming history. The capitalized words means:
a.       Destructive                                                                 c. Encouraging
b.      Scary                                                                             d. Exact
6.       I cannot find _________book, may I photocopy __________ Paul?
a.       MY, YOU                                                                      c. MY, YOURS
b.      MINE, YOURS                                                            d. MINE, YOURS
7.       In Philippine Literature, who is the writer known as “HusengSisiw”?
a.       Jose Rizal                                                                     c. Jose dela Cruz
b.      Francisco Baltazar                                                    d. Andres Bonifacio
8.       “The goddess Aphrodite is the phantom of delight.” The sentence is an example of:
a.       Metaphor                                                                   c. Irony
b.      Simile                                                                            d. Hyperbole
9.       “It was many a many a year ago in a kingdom by the sea, there lived whom you may know by the name of Annabel Lee” This line is from poem written by________________.
a.       John Keats                                                                  c. Edgar Allan Poe
b.      William Wordsworth                                               d. Robert Frost
10.   In the poem Invictus, the line “My head is bloody, but unbowed” is an example of:
a.       Metaphor                                                                   c. Irony
b.      Oxymoron                                                                  d. Hyperbole
11.   Based on the reports of the inspector, the edifice collapse because of __________ joints.
a.       Loose                                                                            c. Edgar Allan Poe
b.      Losing                                                                           d. Robert Frost
12.   Teachers always TRANSMUTE the grades of the students. The capitalized word means:
a.       Change                                                                         c. Upgrade
b.      Degrade                                                                       d. Add
13.   This female Philippine writer in English is known for her sonnets.
a.       Gilda Cordero Fernando                                       c. Edith Tiempo
b.      Ophelia Dimalanta                                                   d. Paz Marquez Benitez
14.   This Shakespearean play talks about the ill fated love affair between two individuals from warring families.
a.       Romeo and Juliet                                                     c. Merchant of Venice
b.      Midsummer Nights Dream                                  d. The twelfth night


15.   The cost of a new computer is quiet expensive for_________ besides we have more urgent things to prioritize.
a.       Us                                                                                   c. We
b.      Them                                                                            d. They
16.   Karenin, Anna’s husband, was betrayed for a number of times and yet he bears no RANCOR in his heart. He is not _____________.
a.       Embarrassed                                                              c. Shy
b.      Bitter                                                                             d. Insulted
17.   The statements of the witness are impertinent to the case because they are__________.
a.       Changeable                                                                                c. Illogical
b.      Irrelevant                                                                    d. Important
18.   The participants look__________, They showed great enthusiasm for the lectures.
a.       Angry                                                                            c. Interested
b.      Offended                                                                    d. Exhausted
19.   The greek literary character who launched a thousand ships is
a.       Patroclus                                                                     c. Helen
b.      Achilles                                                                         d. Agamemnon
20.   Who is the most famous proponent of the Arena Theatre in the Philippines?
a.       Montano                                                                     c. Tinio
b.      Avellans                                                                       d. Carpio
21.   The chief chef instructed his students to be careful not to hurt ___________while slicing the onions..
a.       Them                                                                            c. Ourseslves
b.      Themselves                                                                d. Theirselves
22.   The transport system in the Philippines ___________________drastically improved in the last ten years.
a.       Did improve                                                               c. Has improved
b.      Had improve                                                              d. Has been improving
23.   Mr. Padilla finally found time to sleep after____________for a number of hours.
a.       Having worked                                                          c. Have worked
b.      Working                                                                       d. Had worked
24.   Fish and Fries_____________my favorite afternoon snack.
a.       Is                                                                                     c. Are
b.      Was                                                                               d. Were
25.   When Sam failed his exam for the second time, he resorted to DUTCH COURAGE before he went home to break the news to his family. What does DUTCH COURAGE mean?
a.       A trial or practice performance
b.      Courage which one gets from drinking alcohol
c.       A fair chance to do something
d.      Partial payment paid
26.   Which of the following lines in a metaphor?
a.       “Count money a year of strife-well lost”
b.      “Holy thoughts that star the night”
c.       “Blue waves whitened on a cliff”
d.      “All beautiful and splendid things”


27.   Edgar Allan Poe wrote The Raven from which the line is taken:
And the silken sad uncertain rustling of each purple curtain.
Which of the following  figures  of speech is used by the poet to establish a mood?
a.       Onomatopoeia                                                         c. Allusion
b.      Alliteration                                                                  d. Metaphor
28.   What is the mood of the lines below?
Memory, all alone in the moonlight
I can smile at the old days.
I was beautiful then.
I remember the time
I knew what happiness was
Let the memory live again…
a.       Fear                                                                               c. Nostalgia
b.      Eagerness                                                                   d. Humor
29.   Walter de la Mare wrote Silver from which the lines below are taken:
Slowly, silently, moon the moon
Walks  the night in her silver shoon;
This way, and that, she peers and sees
Silver fruit upon silver trees.

Which figure of speech she used?
a.       Assonance                                                                  c. Metaphor
b.      Personification                                                          d. Simile
30.   When she was younger, Riza believed that Honesty is always the best policy. “She now realizes that although honesty is desirable, it is not always the best policy. Riza’s current thinking is an example of _________________ thinking.
a.       Formal                                                                          c. mythic-literal
b.      conjunctive                                                                d. dialectical
31.   24 is three-fourths of what number?
a.       30                                                                                   c. 24
b.      32                                                                                   d. 16
32.   18% of P36,000 is what percent of P12,960?
a.       50%                                                                                c. 5%
b.      25%                                                                                d. 10%
33.   After receiving 30% discount, Jay paid P210.00 for an item. What is the regular price of the item?
a.       P300                                                                              c. P400
b.      P350                                                                              d. P380
34.   A salesman gets 15% commission for the first P 20,000 and 10% for the amount over P 20,000 of his total sales. How much does he get for total sales of P 50,600?
a.       P8,060                                                                           c. P7,060
b.      P6,060                                                                           d. P5,060
35.   Peter borrowed P 15,000 from the bank at the rate of 12% per year, How much did he owe the bank after 18 months?
a.       P 18,700                                                                       c. P 17,700
b.      P16,000                                                                        d. P 17,000
c.        
36.   A car racer cover 2500 km in 2 hours. How far can he go in 2 ¾ hours?
a.       250 ½ km                                                                     c. 343 ¾ km
b.      340 km                                                                          d. 344 km
37.   Five persons can finish painting a wall within 5 hours. If only 3 people are available, how many hours do they have to work to finish the same job?
a.       7 ½                                                                                                 c. 8
b.      7                                                                                      d. 8 ½
38.   A father decided that his 30-hecatare land be divided among his 33 children using 1:2:3 partition, the oldest getting the biggest share. How much did the second child received??
a.       5 ha                                                                                c. 8 ha
b.      15 ha                                                                             d. 10 ha
39.   A rectangular figure is 6 inches wide and 1 foot long. If the width is to be decreased by 2 inches, but the area remains the same, by how much should the length be increased?
a.       6 inches                                                                        c. 4 inches
b.      8 inches                                                                        d. 10 inches
40.   The average of four numbers is 38. If three of the four numbers are 48, 36, and 24, what is the 4th number?
a.       41                                                                                   c. 40
b.      44                                                                                   d. 42
41.   Thirty students had an average of 75, while 20 students had an average of 90. What is the average of the entire group?
a.       82.5                                                                                c. 81
b.      81.5                                                                                d. 82
42.   One-way fare from Manila to Cebu is P3,800. How many round-trip tickets can be purchased with the amount of P 91,200?
a.       8                                                                                      c. 14
b.      10                                                                                   d. 12
43.   A certain number doubled and decreased by 12 is 8. What is the number?
a.       14                                                                                   c. 10
b.      12                                                                                   d. 8
44.   What is the perimeter of a square board of area 36 square inches?
a.       28 inches                                                                     c. 20 inches
b.      24 inches                                                                     d. 18 inches
45.   The area of a rectangle is 40 square feet. The width is 5 feet. Find its perimeter.
a.       30 ft.                                                                              c. 7 ft
b.      6 ft.                                                                                d. 21 ft
46.   What is the height of a triangle of area 36 units and base 4 units?
a.       18 units                                                                        c. 10 units
b.      12 units                                                                        d. 15 units
47.   A swimming pool is an equilateral triangle in shape. One side is 18 meters. How many meters of rope are needed to enclosed the pool?
a.       54 meters                                                                    c. 48 meters
b.      36meters                                                                     d. 50 meters
48.   A square and an equilateral triangle have equal perimeters. If the side of the square is 3 units less than the side of the triangle, what is the area of the aquare?
a.       64 square units                                                         c. 81 square units
b.      100 square units                                                       d. 144 square units
49.   A ball is drawn at a random from a box containing 4 red, 5 white, and 3 blue balls. Find the probability that the ball is NOT white.
a.       2/3                                                                                 c. 5/12
b.      7/12                                                                               d. ¾
50.   A pair of dice is rolled. Find the probability that the sum “9” appears.
a.       2/9                                                                                 c. 1/3
b.      1/9                                                                                 d. 4/5
51.   A mother wants to have 2 children, both girls. Find the probability that both children will be girls
a.       ½                                                                                     c. 2
b.      100%                                                                             d. ¼
52.   The probability that the wife will survive in 10 years is 3/5 and that of her husband is 2/3. Find the probability that wither one of them will survive.
a.       7/15                                                                               c. 2/5
b.      ½                                                                                     d.1
53.   Simplify   2x-2
4x2 -4
a.     2x + 2                                                       c.  
b.     2x – 2                                                       d

54.   Simplify
55.   Simplify
56.   Jack can finish a certain Job in 5 days. Jill can finish the same job in 7 days. Working together. In how many days can they finish the Job?
a.       12                                                                                   c. 3
b.      4 ½                                                                                                 4. 2 11/12
57.   Jay is twice as old as John. Ten years ago, he was 4 times as old as John. Find Jay’s present age.
a.       20                                                                                   c. 30
b.      25                                                                                   d. 40
58.   How many gallons of 30% solution of HCl acid should be added to 2 gallons of 15% solution of the same acid to make a 20% solution?
a.       2.5                                                                                  c. 1
b.      1.5                                                                                  d. 2
59.   X – 3p, -2x -2p, -5x – p, _____________
a.       -8x                                                                                  c. 8x - p
b.      8x                                                                                   d. 8x+p
60.   Value of n such that 324n0 is divisible by 8.
a.       0                                                                                      c. 2
b.      1                                                                                      d. 3
61.   Isangdulogpampatikanna kung saanangpagpapakahulugansaisangtekstongbinasa ay nakapokussasarilingpanlasangmambabasa at kilalarinsakatawaganna reader-response theory.
a.       Impresyonista                                                           c. antropolohiya
b.      Patalambuhay                                                           d. pansikolohiya
62.   Ibigayangpanagurisapangungusapnanasaibaba.
“mayamansasustansyaanggatas.”
a.       Sustansya                                                            c.  gatas
b.      ang                                                                         d.  mayaman
63.   Tukuyinkunganonguringpanlapiangmatatagpuansamgasumusunodnasalita: kabutihan, pagipunan.
a.       Laguhan                                                               c. unlapi
b.      Gitlapi                                                                   d. kabilaan
64.   Alinsamgasumusunodangtumutukoysaisangtalumpatinabinubuongisangpaksalamang at maagangipinaalamangmgakalahoktungkolsanasabingpaksa?
a.       May kahandaan                                                                c. impromptu
b.      Biglaangtalumpati                                            d. di-handa
65.   Anongbahagingsalitaangnagsasaadng kilos, galaw at pangyayari?
a.       Pangalan                                                              c. pang-uri
b.      Panghalip                                                            d. pandiwa
66.   Ibigaykunganoanganyongpatanongnapangungusapangmatatagpuansaibaba.
“Dumaankanadito, di ba?
a.       Kabalikanganyo                                                c. may karugtong
b.      Pagtanggi                                                            d. panang-ayon
67.   Anoangtamangsalinsaidyomang  “You are the apple of my eyes”?
a.       Masayahinkapala                                             c katuwa-tuwaka
b.      Ikawangmahalagasa akin                              d. Mansanasangpaboritoko
68.   Saponemang segmental, anoanngtinataglayngmgasalitangtanaw, aliw, kamay, reyna?
a.       Ponema                                                               c. diptonggo
b.      Klaster                                                                  d. pares minimal
69.   Angtaonpinag-utosnabawat mag-aaralnamagsisitapossakolehiyo ay dapatnakakuhang 6 nayunitng Filipino?
a.       1968                                                                       c. 1978
b.      1960                                                                       d. 1987
70.   Angpagdagdagngmgatitik “i” at “v” saalpabetongb Filipino ay bahaging ______.
a.       Konotasyon                                                        c. modernisasyon
b.      Denotasyon                                                       d. asimilasyon
71.   Anoangtawagsauringwikananailikhasapamamagitanngpagsasama-samangmgasalitangimpormal at binigyanngbuongkahulugan?
a.       Kolokyal                                                               c. panlalawigan
b.      Lokal                                                                      d. pampanitikan
72.   Anoangtawagsabantasnasinisimbolongsunod-sunodnatatlongtuldokparaipakitana may mgabahaginghindi n sinisipisaisangtalata?
a.       Synopsis                                                              c. sintesis
b.      Ellipsis                                                                   d. abstrak
73.   Isanguringpangungusapnawalangtiyaknapaksananagsasaadngpangyayaringpangkalikasan. Pangkapaligiran.
a.       Penomenal                                                         c. modal
b.      Temporal                                                             d. eksistensyal
74.   Angmgasumusunod ay mgamahahalagangsaliksapagtatalumpati MALIBAN sa_______.
a.       Okasyon                                                              c. tagapakinig
b.      Pagyayabang                                                     d. paksa
75.   Isangimportantengsaliksapagtatalumpatinadapatisaalang-alangngisangtagapagsalita ay ang ________.
a.       MAgyabang                                                        c. matikasnatindig
b.      Malinawnapaliwanag                                     d. Manggulat
76.   Ito ay tumutukoysaprosesongpagpapalitanngkaisipan, opinion o salaysaygamitangmgasimbolo o sagisag.
a.       Pakikinig                                                              c. talastasan
b.      Pagtuklas                                                             d. paglalahad
77.   Anongbahagingpahayaganangnagpapakitang opinion o salaysaygamitangmgasimbolo o sagisag
a.       Pakikinig                                                              c. talastasan
b.      Pagtuklas                                                             d. paglalahad
78.   SinongPilipinongmanunulatangtanyagsakanyangsagisagpanulatna “HusengSisiw”?
a.       Jose Rizal                                                             c. Jose Corazon de Jesus
b.      Jose dela Cruz                                                   d. Francisco Balagtas
79.   Anongbantasangsiyangginagamitsapaghihiwalangmagkakasunodnasalita at liponngmgasalitangmagkaka-uri?
a.       Kuwit                                                                    c. gitling
b.      Tuldukuwit                                                         d. tutuldok
80.   Anoangtawagsapamatnubaynasiyangsinusunodngmga reporter sapagsusulatngpanimulangbalita?
a.       Masaklaw                                                            c. kombensyunal
b.      Masining                                                              d. di-kombensyunal
81.   Anoangwastongpagpapakahulugansaisangidyomang “My bank account is in red”?
a.       Naka-ipon                                                           c. nanakawanngpera
b.      Malapitngmaaubos                                         d. bale-wala
82.   Sapanitikan, anoangtawagsabilangngpantigsabawatblinya o taludtodngisangtula?
a.       Sukat                                                                     c. talinghaga
b.      Kariktan                                                               d. tugma
83.   Ito ay tumutukoysa instrument ngkomunikasyonnasiyangginagamitasapakikipagtalastasan, ugnayan at pagpapalitanngkaisipan.
a.       Tunog                                                                   c. bokabolaryo
b.      Wika                                                                      d. sining
84.   Isangakdani Padre Modesto de Castro nabinubuongpalitannglihamngdalawangmagkapatid. Ito ay naglalamanngmgaparangaltungkolsakagandahangasal at dapatugaliinsaibat-ibangpagkakataon.
a.       Barlaan at Josaphat                                         c. Indarapatra at Sulayman
b.      Urbana at Feliza                                                d. Dasalan at Tocsohan
85.   Isangbaraytingwikanatumutukoysawikangnilikhabataysadimensyongheograpiko. Ito angwikangginagamitsaisangpartikyularnarehiyon, lalawigan o pook, malaki man o maliit.
a.       Etnolek                                                                 c. Sosyolek
b.      Ekolek                                                                   d. dayalekto
86.   Sakomunikasyonnapasulat, alinsamgasumusunodangnararapatnaisaalang-alang?
a.       Lakasngboses                                                    c. Maliksingmgamata
b.      Maayosnapagpapalugit                 d. Pagkibitngbalikat
87.   Anoangtamangpagpapakahulugansaidyomang “the present problem is only a storm in a teacup”?
a.       Bale-wala                                                            c. May galit
b.      Buongpuso                                                         d. matagumpay

88.   Angwika ay pinagkakasunduanngisanglahiupanglubosnamagkakaintindihananglahatngkasapingisangkultura. Anongkatangianngwikaangtinutukoysaunangpahayag?
a.       Dinamiko                                                                             c. masistema
b.      Likas                                                                                      d. arbitraryo
89.   Sananaliksik, saangkabanatamatatagpuanangmgalugar at babasahingmapagkukunanngmgakaugnaynaliteratura at pag-aaral?
a.       Kabanata I                                                                           c. Kabanata II
b.      Kabanata IV                                                                        d. Kabanata V
90.   Anongsangaynglinggwistikaangnakatuonsatamangpagsasaayosngmgasalitaparamakabuongisangpangungusapnanagsasaadngbuongdiwa?
a.       Ponolohiya                                                                         c. semantika
b.      Morpolohiya                                                                      d. sintaks
91.   He declared the date of the Philippine Independence from july 4 to june 12.
a.       Pres. ElpidioQuirino                                                        c. Pres. DiosdadoMacapagal
b.      Pres. Manuel Roxas                                                        d. Pres. Ramon Magsaysay
92.   Maslow is a popular in this theory_________________.
a.       Multiple Intelligence                                                      c. Social Theory
b.      Hierarchy of Needs                                                         d. Constructivism
93.   Who is the Philippine President known as the “father of Social Justice and of the National Language?
a.       ElpidioQuirino                                                                    c. Manuel L. Quezon
b.      Manuel Roxas                                                                   d. Ramon Magsaysay
94.   Which was the 1st Labor union in the Philippine Island founded by Isabelo de los Reyes in 1901?
a.       Union ObreraDemocratica
b.      Union Trabajadores de Filipino
c.       Association of Philippine Labor
d.      Association de Campania Tabacalera
95.   The Philippine archipelago lies in the __________________, an area where many volcanoes are active.
a.       Volcanic rim                                                                        c. Wheel of fire
b.      Achipelagic fault line                                                       d. Ring of fire
96.   What law set the date of the Philippine Independence from America on July 4, 1946 after a 10 year transition
a.       Jones Law                                                                           c. Cooper Act
b.      Tidings McDuffie Law                                                     d. Hare-Hawes-Cutting Bill
97.   As stipulated in Article VI of 1987 Phil. Constitution, which best describes the division of the Legislature into the Senate and the House of the Representatives?
a.       Co-legislative power                                                       c. Unicameralism
b.      Bicameralism                                                                     d. Bipartisanship
98.   It is being recognized as man-made wonders of the Philippines, __________________,
a.       Manila Bay
b.      Taal Volcano
c.       Rice Terraces
d.      Mount Makiling
99.   On June 12, 1898 at Kawit Cavite this band Palyed the Marcha National Filipino during the declaration of Philippines Independence.
a.       Malabon Band                                                                   c. Kawit Cavite Band
b.      San Francisco de Malabon Band                                                d. Kalayaanng Bayan Band

100.                        Libralist advocate ideals in politics, such as justice, equality and fairness. Political realists have a more realistic viewpoint of politics, aptly stated by “Might is Right.” Who among the following is more of a political liberalist rather than a political realist?
a.       Ferdinand Marcos                                                           c. Benigno Aquino
b.      George Bush                                                                      d. Julius Ceasar
101.                        What is the power of the judicial Department in checking the Executive Department following the principles of check and balance among branches of government?
a.       Declaring a legislative measure unconstitutional
b.      Impeachment of the chief Justice of the supreme Court
c.       Determining the salaries of the President and the Vice-President
d.      Declaring an act of the President unconstitutional
102.                        Which religious order first arrived in the Philippines?
a.       Franciscans                                                                         c. Dominicans                                   
b.      Augustinians                                                                      d. Jesuits
103.                        What was the term given by Satirist Marcelo H. del Pilar to the Hidden control and domination by Spanish religious friars over the colonial government?
a.       Las suertepartidas                                                           c. Frailocracia
b.      pase region                                                                        d. complace
104.                        Who was the Spanish governor-general who stablished the “tobacco monopoly” in the Philippines?
a.       BasilioAgustine                                                                 c. Jose Blanco
b.      Francisco Rizzo                                                                  d. Rafael Izquerdo
105.                        Which power of the state enables it to impose charge or burden upon persons, property or property rights for the use and to generate revenue to support the government in its discharge of appropriate functions?
a.       Taxation                                                                               c. Eminent domain
b.      Value added tax                                                               d. Expropriation
106.                        Whose philosophy advocates the use of reason in comprehension about the existence of God?
a.       St. Thomas Aquinas                                                        c. St. Peter
b.      St. John the Baptist                                                         d. St. Benedict
107.                        This was the philosophy which comprises the official statement of Chinese values and way of life during the Han Dynasty.
a.       Loatian philosophy
b.      Confucian Philosophy
c.       Honine Philosophy
d.      Taoist Philosophy
108.                        Which was the first  labor union in the Philippines Island founded by Isabelo de los Reyes in 1901?
a.       Union Trabejadores de Filipinos
b.      Union ObreraDemocratica
c.       Association of Philippine Labor
d.      Association de CompaniaTabacalera
109.                        The Philippine government provides for preferential attention to the welfare of the less fortunate, What policy stipulates this?
a.       Social Justice
b.      Criminal Justice
c.       Distributive Justice
d.      Bill of rights

110.                        If the social system is based on meritocracy, which is possible effect?
a.       Rule by the wealthy an powerfi
b.      Leadership by the people of talent
c.       Culture of elitism
d.      Rule by those of noble birth
111.                        If principles and theories of human behavior were to be applied to teaching and learning the field will be called
a.       Educational theory                                                          c. Educational psychology
b.      Educational Philosophy                                                 d. Educational sociology
112.                        When classics are revived, how are they called in social trends?
a.       Existentialists                                                                     c. unicameralism             
b.      Rationalist                                                                           d. bipartnerships
113.                        Participation in governance, including the right to vote and seek public office is secured within the citizenry’s_____________.
a.       Right to due process
b.      Socio-civic rights
c.       Political Rights
d.      Rights of suffrage
114.                        Considering “tayo-tayo” mentality of the Filipinos, one goal for CHANGE that should be worked on is to develop _____________.
a.       A sense of common good
b.      A sense of national pride
c.       “Pakikisama”
d.      The habits of discipline and hard work

115.                        Who was the literary figure behind a pseudonym “HusengSisiw”?
a.       Jose Rizal
b.      Jose dela Cruz
c.       Antonio Lun
d.      Francisco Balagtas
116.                        Who were the aborigines prior to succeeding migrants who crossed the seas from across the southerb Philippines?
a.       Sumatrans                                                                          c. Malayans
b.      Borneans                                                                             d. Negritos
117.                        Article 1 of the Universal Declaration of Human Rights that “the Universal Declaration of Human Rights advocated that all human beings are born free and equal dignity and rights.” Which of the following a VIOLATION of human rights?
a.       Settling requirements for a government job
b.      Not allowing education graduates without a license to teach
c.       Disqualification from job due to ethnic affiliation
d.      Selective admission for college education
118.                        What do you call an organism that feed of another organism for survival?
a.       Parasite                                                                                c. Prey
b.      Commensal                                                                        d. Host

119.                        Amoeba, a single-celled organism, has thin structures essential for cytokinesis, movement and changes in its shape. These structures are called?
a.       Microfilaments                                                                 c. Macrofilaments
b.      Pseudopodia                                                                     d.  Analogous structure
120.                        Prokaryotic cells are different from eukaryotic cells because prokaryotes have
a.       Small ribosomes used for protein synthesis
b.      Nucleic acid found inside a nucleus
c.       Mitochondria that participates in cellular respiration
d.      Genome that is located in the nucleoid
121.                        The cellular metabolic process that transforms biochemical enegy into adenosine triphosphate (ATP) is
a.       Cellular Respiration                                                         c. Cellular breakdown
b.      Cellular Metabolism                                                        d. Cellular reaction
122.                        Which of the following is true recessive genes?
a.       They are more aggressive and have more superior phenotypic traits
b.      The will only have phenotypic expression if they are homozygous
c.       They will prevent a dominant gene from expressing its phenotype
d.      They should be paired with dominant gene in order to be expressed
123.                        The vermiform appendix, though a part of the large intestine has no digestive function. It is therefore called_________.
a.       Addendum organ                                                            c. Vestigial structure
b.      Embryonic organ                                                              d. Analogous structure
124.                        Hemophilia is a common sex-linked disorder that is x-linked recessive trait. If a man is hemophiliac, this means that
a.       He got the disease from his mother
b.      He will have children with hemophilia
c.       All his brothers and sisters will be hemophiliac
d.      None of his brothers and sisters will be hemophiliac
125.                        Of the following organisms listed below, which one is considered heterotrophic?
a.       Bacteria                                                                                c. Bacteria
b.      Moss                                                                                     d. Grasshopper
126.                        Which one of the following organisms is considered as fungus?
a.       Amoeba                                                                               c. Bacteria                          
b.      Yeast                                                                                     d. Magnolia
127.                        Which of the following pairs of body parts is considered homologous?
a.       Human Arms and Seal’s Flippers                                               c. Lungs and gills
b.      Appendix and Tail Bone                                                                d. Ectoderm and Endoderm
128.                        A person with diabetes has insulin deficiency. What organ secretes insulin?
a.       Liver                                                                                      c. Pancreas
b.      Kidney                                                                                  d. Thyroid
129.                        In the traditional medicine, this segmented worm is used to facilitate coagulation. What is this organism?
a.       Leech                                                                                    c. Maggot
b.      Earthworm                                                                         d. Flatworm
130.                        What do you call the molecules that contain the organism’s genetic information?
a.       Organelles                                                                          c. Nucleus
b.      Nucleic acid                                                                        d. Mitochondria
131.                        What hormones in plants are responsible in promoting auxillary budding and apical dominance?
a.       Aucin and Gibbrelins                                                      c. Auxin and Abscisates
b.      Cytokinin and Gibbrelins                                               d. Cytokinins and Auxins
132.                        Of the following organisms, which one feeds on dead and decaying matter?
a.       Vulture                                                                                 c. Yeast
b.      Flatworm                                                                             d. Hawk
133.                        Commensalism is an interaction between two organisms whereby one organism is benefited while others is not affected. This is exemplified by which of the following?
a.       Two spiders fight each other for survival
b.      A flea feeds in the blood of the dog
c.       A bird following the army ant is able to catch and eat the fleeing insects which are caused by the army and colony
d.      A soaring eagle catches ad devour the chick
134.                        Which of the following shows the transfer of food between all life forms?
a.       Nutrition cycle                                                                   c. biogeochemical cycle
b.      Food web                                                                            d. Hydrologic pathway
135.                        An ecosystem that suffered ecological imbalance can recover naturally through
a.       Ecological Succession                                                      c. Ecological Niche
b.      Ecological Evolution                                                         d. Ecological rebirth
136.                        It is predicted that by year 2040, the demand for the energy will be doubled. Because of this, there will be an increased need to continue support for
a.       Global warming                                                                                c. Economic Growth
b.      Climate Change                                                                d. Mass Transport
137.                        Of the following listed below, which one is considered as the most disadvantageous source of energy since it gives detrimental effect on the population food supply?
a.       Solar                                                                                      c. Wind
b.      Geothermal                                                                       d. Hydroelectric plant
138.                        Which of the following does not contribute to greenhouse effect?
a.       Use of detergent                                                             c. Burning of waste
b.      Forest fires                                                                         d. Deforestation
139.                        The major concern about global warming arises from increased concentration of
a.       Greenhouse gases                                                          c. Photochemical smog
b.      Acid Rain                                                                              d. Aerosols
140.                        Which of the following is true when a block of wood lays at rest on top of the table?
a.       There are no forces acting on the block
b.      The sum of the forces acting on the block is zero
c.       The block is in uniform motion
d.      The block is accelerated
141.                        A razor blade can float on the surface of water because of
a.       Surface tension
b.      Capillarity
c.       Buoyant force
d.      Liquid pressure
142.                        Where does visible light fall on the electromagnetic spectrum?
a.       Between infrared and ultraviolet radiations
b.      Between FM and AM radio waves
c.       Between microwaves and infrared radiations
d.      Between gamma rays and x-rays
143.                        Which of the following substances listed below is considered a colloid?
a.       Water                                                                                   c. soda
b.      Alcohol                                                                                                 d. milk
144.                        Which of the following is a characteristics of metalloids?
a.       They are  poor conductors of heat
b.      They conduct electricity better than metals
c.       They have properties of both metals and non-metals
145.                        An atom of silicon has an atomic number of 14 and atomic mass of 28. It can be inferred that this element has
a.       14 protons, 14 electrons and 28 neutrons
b.      14 protons, 14 electrons and 14 neutrons
c.       14 protons, 28 electrons and 14 neutrons
d.      14 protons, 28 electrons and 28 neutrons
146.                        What term is given to the surface of the Earth between the trophic of cancer and the equator?
a.       Great Circle                                                                        c. Zone
b.      Meridian                                                                              d. Solstice
147.                        The Philippines , together with other countries along the borders of pacific ocean, lies along the plate where earthquakes and volcanic activities are more frequent. This plate is known as
a.       West Vallety fault
b.      Pacific Ring of Fire
c.       Archipelagic Fault line
d.      Pacific Volcanic rim
148.                        Which is the most effective to use in showing concepts textually and visually to a large audience?
a.       Desktop publisher                                                           c. Spread spreadsheet
b.      Powerpoint Presentation                                             d. Web browser
149.                        Which of the following best presents numerical data in a graphical format?
a.       Histogram                                                                           c. Organizational Chart
b.      Word web                                                                           d. Venn Diagram
150.                        Which of the following is the most effective tool for journal writing in the internet?
a.       Microsoft Outlook                                                           c. Spotify
b.      Instagram                                                                            d. Blog





0 Response to "General Education (150 Questions)"

Post a Comment